PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_29353.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 271aa    MW: 30382.1 Da    PI: 10.0406
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_29353.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM81.61.7e-2526564128
                      NAM  64 rdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              rd+ky++g+r+nr++ +gyWkatg+dk ++s +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Sme2.5_29353.1_g00001.1   2 RDRKYPNGSRPNRVAGTGYWKATGTDKVITS-QGRKVGIKKALVFYVGKAPKGSKTNWIMHEYRL 65 
                              79****************************9.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100536.539188IPR003441NAC domain
SuperFamilySSF1019413.92E-35189IPR003441NAC domain
PfamPF023652.5E-101265IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
PRDRKYPNGS RPNRVAGTGY WKATGTDKVI TSQGRKVGIK KALVFYVGKA PKGSKTNWIM  60
HEYRLFEPSR KNGSAKLDDW VLCRIYKKNS SGLKPLMSGL HSSNEYSHGS SASSSSQFDD  120
MLESLPEMDD RFPNLPRLNS LKTEKLNLER LDSANFDWAI LAGLKPMPEA AGIQAQAQAQ  180
VPTHVNHLIH NHNNMNFAND VYAHPTNFRG NAKVESITFD EEVESGIRNQ RADKSGYFQQ  240
ALGGFSQTYT NGMDQFGIQR PNQTLNLGFR Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-5519481174NAC domain-containing protein 19
3swm_B1e-5519481174NAC domain-containing protein 19
3swm_C1e-5519481174NAC domain-containing protein 19
3swm_D1e-5519481174NAC domain-containing protein 19
3swp_A1e-5519481174NAC domain-containing protein 19
3swp_B1e-5519481174NAC domain-containing protein 19
3swp_C1e-5519481174NAC domain-containing protein 19
3swp_D1e-5519481174NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM4352670.0KM435267.1 Solanum melongena NAC gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233972.11e-158jasmonic acid 2
SwissprotQ93VY32e-72NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A0A1G3R00.0A0A0A1G3R0_SOLME; NAC
STRINGSolyc12g013620.1.11e-157(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.22e-69NAC family protein